2.50 Rating by CuteStat

telepaisa.com is 1 decade 8 years old. It is a domain having com extension. It has a global traffic rank of #1276757 in the world. This website is estimated worth of $ 960.00 and have a daily income of around $ 4.00. As no active threats were reported recently by users, telepaisa.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 659
Daily Pageviews: 1,318

Estimated Valuation

Income Per Day: $ 4.00
Estimated Worth: $ 960.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,276,757
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

23.229.194.8

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 23.229.194.8)

Coming Soon - Future home of something quite cool

- pitchtofund.com
Not Applicable $ 8.95

Coming Soon

- alnada-bdc.com
Not Applicable $ 8.95

ACS Roofing Company | (832) 593-0027

- acsroofingcompany.com

This is valuable website which provides the information about the ACS Roofing Company.

13,213,249 $ 8.95

Accent Builders DFW

- accentbuildersdfw.com

This is a valuable website which provides information about the Accent Builder DFW

Not Applicable $ 8.95

Lawn Sprinkler System in Cincinnati | Paramount Landscaping (513) 984-

- cincinnatilawnsprinklersystem.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 03 Jan 2021 16:29:35 GMT
Server: Apache
X-Powered-By: PHP/5.4.45
Refresh: 0; url=http://www.telepaisa.com/producciones.php?action=portada
Upgrade: h2,h2c
Connection: Upgrade
Vary: User-Agent
Content-Length: 0
Content-Type: text/html

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Oct 13, 2005, 5:33 AM 1 decade 8 years 6 months ago
Expiration Date: Oct 13, 2024, 5:33 AM 5 months 2 weeks 4 days from now
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns01.domaincontrol.com 97.74.100.1 United States of America United States of America
ns02.domaincontrol.com 173.201.68.1 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
telepaisa.com A 10799 IP: 23.229.194.8
telepaisa.com NS 3600 Target: ns01.domaincontrol.com
telepaisa.com NS 3600 Target: ns02.domaincontrol.com
telepaisa.com SOA 86400 MNAME: ns01.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016050200
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
telepaisa.com MX 3600 Target: mail.telepaisa.com
telepaisa.com TXT 3600 TXT: v=spf1 a mx ptr include:secureserver.net
~all

Similarly Ranked Websites

Teen Porn Videos Teen Sex Movies Teen 18 Teen

- teen18teen.com

Teen 18 Porn Tube Best Teen Sex Videos Teen Porn Movies and Amateur Teen Sextapes

1,276,759 $ 480.00


Vu Long Tran

- vulongtran.com

Sharing on tech, stories and learnings with you...

1,276,759 $ 1,200.00

Local Website Designer Bristol - Your website designer Bristol by loca

- websitedesignerbristol.com

Local Website Designers. Your local website designers, produce website designs for both business and Personal use. Contact your local website designer today for promotions covering Bristol, Bath, Cheltenham, Gloucester, Glos, Swindon, Bath, Weston, Portishead

1,276,762 $ 480.00

Free porn @ XNXX

- xxnl.com
1,276,763 $ 960.00

Full WHOIS Lookup

Domain Name: TELEPAISA.COM
Registry Domain ID: 229093510_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-10-16T19:07:17Z
Creation Date: 2005-10-12T23:48:02Z
Registrar Registration Expiration Date: 2024-10-12T23:48:02Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: TELEPAISA
Registrant State/Province: Zacatecas
Registrant Country: MX
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=TELEPAISA.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=TELEPAISA.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=TELEPAISA.COM
Name Server: NS01.DOMAINCONTROL.COM
Name Server: NS02.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-01-03T16:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

TERMS OF USE: The data contained in this registrar's Whois database, while believed by the
registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its
accuracy. This information is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of this data for any other purpose
is expressly forbidden without the prior written permission of this registrar. By submitting
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not
to use this data to allow, enable, or otherwise support the dissemination or collection of this
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations
of any kind, including spam. You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data for any purpose, including
mining this data for your own personal or commercial purposes. Failure to comply with these terms
may result in termination of access to the Whois database. These terms may be subject to modification
at any time without notice.